PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC8152_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 206aa    MW: 22606.9 Da    PI: 6.7918
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC8152_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.46.8e-101248237
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl 37
                ++R+++tkeq++ Le+l+++  r+psa+++++++ +l
  RrC8152_p1 12 SPRWNPTKEQITLLENLYKQgIRTPSADQIQQITGRL 48
                58*****************99*************988 PP

2Wus_type_Homeobox63.35e-211155246
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkie 46
                       +++RW+Pt+eQi++Le+lyk+G+rtP++++iq+it +L+++G+ie
         RrC8152_p1 11 SSPRWNPTKEQITLLENLYKQGIRTPSADQIQQITGRLRAFGHIE 55
                       689*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF000461.9E-71348IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MENERSAVTT SSPRWNPTKE QITLLENLYK QGIRTPSADQ IQQITGRLRA FGHIEVGCVS  60
PNYLHQVSDN QHGSSHRQDL HSNKVMLPSG GYEKRTITDH KKHVSDITTA RISMSSSSLR  120
FDRFSLGDHG YFGEGINVNT NGLKTLPLFP LQPLDASNDD VAGNSSFSPC HDSPVTYCGD  180
DGGRGPSFID FFSGGSSRFD NFGNGL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013716707.11e-111PREDICTED: WUSCHEL-related homeobox 2-like
SwissprotQ6X7K14e-86WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLA0A078CU341e-119A0A078CU34_BRANA; BnaC09g34650D protein
TrEMBLA0A078H3671e-119A0A078H367_BRANA; BnaA10g12360D protein
STRINGBra002576.1-P1e-113(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69142844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.14e-77WUSCHEL related homeobox 2